Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4660962..4661643 | Replicon | chromosome |
Accession | NZ_CP097256 | ||
Organism | Pseudomonas aeruginosa strain D5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | M4954_RS21665 | Protein ID | WP_003111825.1 |
Coordinates | 4661278..4661643 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M4954_RS21660 | Protein ID | WP_003145733.1 |
Coordinates | 4660962..4661285 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4954_RS21635 (M4954_21635) | 4656875..4657513 | + | 639 | WP_003109444.1 | hypothetical protein | - |
M4954_RS21640 (M4954_21640) | 4657756..4658091 | + | 336 | WP_003140884.1 | TM2 domain-containing protein | - |
M4954_RS21645 (M4954_21645) | 4658265..4658783 | + | 519 | WP_022579807.1 | PAAR domain-containing protein | - |
M4954_RS21650 (M4954_21650) | 4658780..4659481 | + | 702 | WP_003111822.1 | VRR-NUC domain-containing protein | - |
M4954_RS21655 (M4954_21655) | 4659498..4660586 | + | 1089 | WP_034025227.1 | DUF3396 domain-containing protein | - |
M4954_RS21660 (M4954_21660) | 4660962..4661285 | - | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
M4954_RS21665 (M4954_21665) | 4661278..4661643 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4954_RS21670 (M4954_21670) | 4661907..4662146 | - | 240 | WP_049876884.1 | hypothetical protein | - |
M4954_RS21675 (M4954_21675) | 4662353..4662625 | + | 273 | WP_003085667.1 | hypothetical protein | - |
M4954_RS21680 (M4954_21680) | 4662644..4663069 | - | 426 | WP_003114206.1 | VOC family protein | - |
M4954_RS21685 (M4954_21685) | 4663170..4664054 | + | 885 | WP_003114205.1 | LysR family transcriptional regulator | - |
M4954_RS21690 (M4954_21690) | 4664027..4664980 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
M4954_RS21695 (M4954_21695) | 4665201..4665635 | + | 435 | WP_010793869.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T245063 WP_003111825.1 NZ_CP097256:c4661643-4661278 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|