Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4538671..4539273 | Replicon | chromosome |
| Accession | NZ_CP097255 | ||
| Organism | Enterobacter bugandensis strain CMCC(B)45301 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A167J774 |
| Locus tag | M1V99_RS22080 | Protein ID | WP_047366784.1 |
| Coordinates | 4538962..4539273 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M1V99_RS22075 | Protein ID | WP_194386695.1 |
| Coordinates | 4538671..4538961 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1V99_RS22060 (M1V99_22060) | 4536169..4537071 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
| M1V99_RS22065 (M1V99_22065) | 4537068..4537703 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M1V99_RS22070 (M1V99_22070) | 4537700..4538629 | + | 930 | WP_028014872.1 | formate dehydrogenase accessory protein FdhE | - |
| M1V99_RS22075 (M1V99_22075) | 4538671..4538961 | - | 291 | WP_194386695.1 | NadS family protein | Antitoxin |
| M1V99_RS22080 (M1V99_22080) | 4538962..4539273 | - | 312 | WP_047366784.1 | hypothetical protein | Toxin |
| M1V99_RS22085 (M1V99_22085) | 4539422..4540363 | - | 942 | WP_047366783.1 | fatty acid biosynthesis protein FabY | - |
| M1V99_RS22090 (M1V99_22090) | 4540408..4540845 | - | 438 | WP_008501836.1 | D-aminoacyl-tRNA deacylase | - |
| M1V99_RS22095 (M1V99_22095) | 4540842..4541723 | - | 882 | WP_045260235.1 | virulence factor BrkB family protein | - |
| M1V99_RS22100 (M1V99_22100) | 4541717..4542316 | - | 600 | WP_045260234.1 | glucose-1-phosphatase | - |
| M1V99_RS22105 (M1V99_22105) | 4542404..4542874 | - | 471 | WP_028014878.1 | hypothetical protein | - |
| M1V99_RS22110 (M1V99_22110) | 4542871..4543614 | - | 744 | WP_194386694.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12135.13 Da Isoelectric Point: 8.8415
>T245058 WP_047366784.1 NZ_CP097255:c4539273-4538962 [Enterobacter bugandensis]
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPEYGDVIQNTGGLRKIRWLAGGKGKRGGVRVIYFYRTCEFEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPEYGDVIQNTGGLRKIRWLAGGKGKRGGVRVIYFYRTCEFEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|