Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3573177..3573834 | Replicon | chromosome |
Accession | NZ_CP097255 | ||
Organism | Enterobacter bugandensis strain CMCC(B)45301 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M1V99_RS17380 | Protein ID | WP_048957972.1 |
Coordinates | 3573177..3573476 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M1V99_RS17385 | Protein ID | WP_047367527.1 |
Coordinates | 3573487..3573834 (+) | Length | 116 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1V99_RS17355 (M1V99_17355) | 3569437..3569622 | + | 186 | WP_249488143.1 | hypothetical protein | - |
M1V99_RS17360 (M1V99_17360) | 3569647..3570069 | + | 423 | WP_249488144.1 | hypothetical protein | - |
M1V99_RS17365 (M1V99_17365) | 3570083..3570481 | + | 399 | WP_249488145.1 | hypothetical protein | - |
M1V99_RS17370 (M1V99_17370) | 3570575..3571669 | + | 1095 | WP_249488146.1 | ATP-binding cassette domain-containing protein | - |
M1V99_RS17375 (M1V99_17375) | 3571666..3572873 | + | 1208 | Protein_3297 | HlyD family efflux transporter periplasmic adaptor subunit | - |
M1V99_RS17380 (M1V99_17380) | 3573177..3573476 | + | 300 | WP_048957972.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M1V99_RS17385 (M1V99_17385) | 3573487..3573834 | + | 348 | WP_047367527.1 | HigA family addiction module antitoxin | Antitoxin |
M1V99_RS17390 (M1V99_17390) | 3573836..3574567 | - | 732 | WP_048998571.1 | helix-turn-helix transcriptional regulator | - |
M1V99_RS17395 (M1V99_17395) | 3574747..3575088 | + | 342 | WP_249488147.1 | nuclear transport factor 2 family protein | - |
M1V99_RS17400 (M1V99_17400) | 3575134..3576315 | - | 1182 | WP_047367525.1 | PLP-dependent aminotransferase family protein | - |
M1V99_RS17405 (M1V99_17405) | 3576336..3577223 | - | 888 | WP_045260881.1 | LysR family transcriptional regulator | - |
M1V99_RS17410 (M1V99_17410) | 3577321..3577923 | + | 603 | WP_249488148.1 | short chain dehydrogenase | - |
M1V99_RS17415 (M1V99_17415) | 3577917..3578651 | - | 735 | WP_249488149.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11538.15 Da Isoelectric Point: 10.0104
>T245056 WP_048957972.1 NZ_CP097255:3573177-3573476 [Enterobacter bugandensis]
MINHFRDQWLKDFFLYGKSSNVIPSSLESALARKLDMINAATSHRELRSPPGNMYESLNPPLAGYSAIRVNRQYRLVFRW
SEGKADDLYLSPHKYTPYK
MINHFRDQWLKDFFLYGKSSNVIPSSLESALARKLDMINAATSHRELRSPPGNMYESLNPPLAGYSAIRVNRQYRLVFRW
SEGKADDLYLSPHKYTPYK
Download Length: 300 bp
Antitoxin
Download Length: 116 a.a. Molecular weight: 13126.08 Da Isoelectric Point: 7.0141
>AT245056 WP_047367527.1 NZ_CP097255:3573487-3573834 [Enterobacter bugandensis]
MTLQQALRKPTTPGDVLQYEYLEPLNLKISDLAEMLNVHRNTISALVNNNRKLTADMAIRLAKAFDTTIEFWLNLQLNVD
VWEAQTNSRTQEELSRIKTIAEIMAKRKSGQPDVA
MTLQQALRKPTTPGDVLQYEYLEPLNLKISDLAEMLNVHRNTISALVNNNRKLTADMAIRLAKAFDTTIEFWLNLQLNVD
VWEAQTNSRTQEELSRIKTIAEIMAKRKSGQPDVA
Download Length: 348 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|