Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 11796..12655 | Replicon | plasmid pCMCCB45301 |
Accession | NZ_CP097254 | ||
Organism | Enterobacter bugandensis strain CMCC(B)45301 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | M1V99_RS00065 | Protein ID | WP_108376731.1 |
Coordinates | 11796..12290 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | M1V99_RS00070 | Protein ID | WP_108376736.1 |
Coordinates | 12311..12655 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1V99_RS00040 (M1V99_00045) | 7639..7878 | + | 240 | WP_230041377.1 | hypothetical protein | - |
M1V99_RS00045 (M1V99_00050) | 8300..9058 | - | 759 | WP_249488039.1 | hypothetical protein | - |
M1V99_RS00050 (M1V99_00055) | 9221..10069 | - | 849 | WP_108376733.1 | DUF4942 domain-containing protein | - |
M1V99_RS00055 (M1V99_00060) | 10261..10941 | - | 681 | WP_249488040.1 | hypothetical protein | - |
M1V99_RS00060 (M1V99_00065) | 11038..11286 | - | 249 | WP_223239720.1 | hypothetical protein | - |
M1V99_RS00065 (M1V99_00070) | 11796..12290 | - | 495 | WP_108376731.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
M1V99_RS00070 (M1V99_00075) | 12311..12655 | - | 345 | WP_108376736.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
M1V99_RS00075 (M1V99_00080) | 12987..13205 | - | 219 | WP_188246026.1 | type II toxin-antitoxin system VapB family antitoxin | - |
M1V99_RS00080 (M1V99_00085) | 13445..13675 | - | 231 | WP_188246027.1 | hypothetical protein | - |
M1V99_RS00085 (M1V99_00090) | 13666..13929 | - | 264 | WP_188246028.1 | DUF1380 family protein | - |
M1V99_RS00090 (M1V99_00095) | 14036..14317 | - | 282 | WP_188246032.1 | hypothetical protein | - |
M1V99_RS00095 (M1V99_00100) | 14466..14984 | - | 519 | WP_188246029.1 | hypothetical protein | - |
M1V99_RS00100 (M1V99_00105) | 14974..15348 | - | 375 | WP_249488041.1 | hypothetical protein | - |
M1V99_RS00105 (M1V99_00110) | 15360..15629 | - | 270 | WP_249488042.1 | hypothetical protein | - |
M1V99_RS00110 (M1V99_00115) | 15736..16167 | - | 432 | WP_188246031.1 | antirestriction protein | - |
M1V99_RS00115 (M1V99_00120) | 16483..16713 | + | 231 | WP_249488043.1 | hypothetical protein | - |
M1V99_RS00120 (M1V99_00125) | 16987..17424 | - | 438 | WP_188246038.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81691 | 81691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 19174.06 Da Isoelectric Point: 8.6417
>T245048 WP_108376731.1 NZ_CP097254:c12290-11796 [Enterobacter bugandensis]
MEYLELNGWKICFHKCFLDQIAELAQKVAELKAAKPNEYHKKKETKLLLAIERVIEEWIASDPLNPQYRQGDTLGDEYKH
WFRVKFLQQFRLFYRCSQEHKTIIIGWVNDFDTLRAYGSKTDAYKVFAEMLKAGTPPDDWNTLLNAAKKATATNTIPGFL
TRQP
MEYLELNGWKICFHKCFLDQIAELAQKVAELKAAKPNEYHKKKETKLLLAIERVIEEWIASDPLNPQYRQGDTLGDEYKH
WFRVKFLQQFRLFYRCSQEHKTIIIGWVNDFDTLRAYGSKTDAYKVFAEMLKAGTPPDDWNTLLNAAKKATATNTIPGFL
TRQP
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|