Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2583979..2584574 | Replicon | chromosome |
Accession | NZ_CP097252 | ||
Organism | Mesorhizobium opportunistum strain WSM1558 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | M5D98_RS12475 | Protein ID | WP_224687692.1 |
Coordinates | 2584293..2584574 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5D98_RS12470 | Protein ID | WP_023779626.1 |
Coordinates | 2583979..2584278 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5D98_RS12425 (M5D98_12425) | 2579012..2579149 | - | 138 | WP_023768804.1 | hypothetical protein | - |
M5D98_RS12430 (M5D98_12430) | 2579194..2579460 | - | 267 | WP_013893514.1 | hypothetical protein | - |
M5D98_RS12435 (M5D98_12435) | 2579457..2579726 | - | 270 | WP_224687696.1 | hypothetical protein | - |
M5D98_RS12440 (M5D98_12440) | 2579913..2580119 | - | 207 | WP_224687695.1 | cold-shock protein | - |
M5D98_RS12445 (M5D98_12445) | 2580448..2580672 | + | 225 | WP_140571906.1 | hypothetical protein | - |
M5D98_RS12450 (M5D98_12450) | 2580857..2582494 | + | 1638 | WP_224687694.1 | tetratricopeptide repeat-containing sulfotransferase family protein | - |
M5D98_RS12455 (M5D98_12455) | 2582530..2582883 | - | 354 | WP_023768800.1 | DUF1428 domain-containing protein | - |
M5D98_RS12460 (M5D98_12460) | 2583081..2583503 | - | 423 | WP_224687693.1 | glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | - |
M5D98_RS12465 (M5D98_12465) | 2583663..2583845 | - | 183 | WP_023779625.1 | hypothetical protein | - |
M5D98_RS12470 (M5D98_12470) | 2583979..2584278 | - | 300 | WP_023779626.1 | HigA family addiction module antitoxin | Antitoxin |
M5D98_RS12475 (M5D98_12475) | 2584293..2584574 | - | 282 | WP_224687692.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5D98_RS12480 (M5D98_12480) | 2584692..2586218 | - | 1527 | WP_224687691.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
M5D98_RS12485 (M5D98_12485) | 2586594..2587499 | - | 906 | WP_224687690.1 | DMT family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10508.86 Da Isoelectric Point: 10.2058
>T245038 WP_224687692.1 NZ_CP097252:c2584574-2584293 [Mesorhizobium opportunistum]
MIRSFKDKTSEAVSNGKSPKGFPSDLVRSAQRKLFMIDNATELSDLKTPPGNRLESLKGNRAGQHSIRINDQFRICFRWV
NGQAEGVEITDYH
MIRSFKDKTSEAVSNGKSPKGFPSDLVRSAQRKLFMIDNATELSDLKTPPGNRLESLKGNRAGQHSIRINDQFRICFRWV
NGQAEGVEITDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|