Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2866321..2867096 | Replicon | chromosome |
Accession | NZ_CP097248 | ||
Organism | Klebsiella pneumoniae strain NTU107224 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A332L402 |
Locus tag | M5D84_RS13945 | Protein ID | WP_021314147.1 |
Coordinates | 2866611..2867096 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | M5D84_RS13940 | Protein ID | WP_004150912.1 |
Coordinates | 2866321..2866614 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5D84_RS13920 (2861529) | 2861529..2862131 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
M5D84_RS13925 (2862229) | 2862229..2863140 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
M5D84_RS13930 (2863141) | 2863141..2864289 | - | 1149 | WP_032417597.1 | PLP-dependent aspartate aminotransferase family protein | - |
M5D84_RS13935 (2864300) | 2864300..2865676 | - | 1377 | WP_073553579.1 | cystathionine beta-synthase | - |
M5D84_RS13940 (2866321) | 2866321..2866614 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
M5D84_RS13945 (2866611) | 2866611..2867096 | + | 486 | WP_021314147.1 | GNAT family N-acetyltransferase | Toxin |
M5D84_RS13950 (2867800) | 2867800..2868393 | + | 594 | WP_004188553.1 | hypothetical protein | - |
M5D84_RS13955 (2868490) | 2868490..2868706 | + | 217 | Protein_2712 | transposase | - |
M5D84_RS13965 (2869221) | 2869221..2869934 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2868490..2868642 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17621.68 Da Isoelectric Point: 8.5144
>T245027 WP_021314147.1 NZ_CP097248:2866611-2867096 [Klebsiella pneumoniae]
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MILAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A332L402 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |