Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2468979..2469565 Replicon chromosome
Accession NZ_CP097248
Organism Klebsiella pneumoniae strain NTU107224

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M5D84_RS11880 Protein ID WP_002920800.1
Coordinates 2469197..2469565 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5D84_RS11875 Protein ID WP_004174006.1
Coordinates 2468979..2469200 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5D84_RS11855 (2465136) 2465136..2466062 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5D84_RS11860 (2466059) 2466059..2467336 + 1278 WP_087842631.1 branched chain amino acid ABC transporter permease LivM -
M5D84_RS11865 (2467333) 2467333..2468100 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5D84_RS11870 (2468102) 2468102..2468815 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5D84_RS11875 (2468979) 2468979..2469200 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5D84_RS11880 (2469197) 2469197..2469565 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5D84_RS11885 (2469838) 2469838..2471154 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5D84_RS11890 (2471261) 2471261..2472148 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5D84_RS11895 (2472145) 2472145..2472990 + 846 WP_064188333.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5D84_RS11900 (2472992) 2472992..2474062 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2466059..2474799 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T245025 WP_002920800.1 NZ_CP097248:2469197-2469565 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT245025 WP_004174006.1 NZ_CP097248:2468979-2469200 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References