Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3148605..3149202 | Replicon | chromosome |
| Accession | NZ_CP097237 | ||
| Organism | Klebsiella pneumoniae strain | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M4268_RS15050 | Protein ID | WP_004142563.1 |
| Coordinates | 3148605..3148922 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M4268_RS15055 | Protein ID | WP_004142561.1 |
| Coordinates | 3148915..3149202 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4268_RS15035 (3144308) | 3144308..3145735 | - | 1428 | WP_043906839.1 | MFS transporter | - |
| M4268_RS15040 (3145844) | 3145844..3146710 | + | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
| M4268_RS15045 (3147377) | 3147377..3148420 | + | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
| M4268_RS15050 (3148605) | 3148605..3148922 | + | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4268_RS15055 (3148915) | 3148915..3149202 | + | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M4268_RS15060 (3149470) | 3149470..3150120 | - | 651 | Protein_2931 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M4268_RS15065 (3150240) | 3150240..3150608 | - | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| M4268_RS15070 (3150608) | 3150608..3151189 | - | 582 | WP_043906838.1 | TetR/AcrR family transcriptional regulator | - |
| M4268_RS15075 (3151369) | 3151369..3152484 | + | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
| M4268_RS15080 (3152515) | 3152515..3152856 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M4268_RS15085 (3152874) | 3152874..3153122 | - | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T245005 WP_004142563.1 NZ_CP097237:3148605-3148922 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |