Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1413553..1414139 Replicon chromosome
Accession NZ_CP097237
Organism Klebsiella pneumoniae strain

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M4268_RS06960 Protein ID WP_002920800.1
Coordinates 1413553..1413921 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M4268_RS06965 Protein ID WP_004174006.1
Coordinates 1413918..1414139 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4268_RS06940 (1409056) 1409056..1410126 - 1071 WP_043906884.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
M4268_RS06945 (1410128) 1410128..1410973 - 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M4268_RS06950 (1410970) 1410970..1411857 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M4268_RS06955 (1411964) 1411964..1413280 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M4268_RS06960 (1413553) 1413553..1413921 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M4268_RS06965 (1413918) 1413918..1414139 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4268_RS06970 (1414303) 1414303..1415016 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M4268_RS06975 (1415018) 1415018..1415785 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M4268_RS06980 (1415782) 1415782..1417059 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M4268_RS06985 (1417056) 1417056..1417982 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1408319..1417059 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T244999 WP_002920800.1 NZ_CP097237:c1413921-1413553 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT244999 WP_004174006.1 NZ_CP097237:c1414139-1413918 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References