Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1987733..1988330 | Replicon | chromosome |
| Accession | NZ_CP097232 | ||
| Organism | Klebsiella pneumoniae strain 4 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M4269_RS09745 | Protein ID | WP_004142563.1 |
| Coordinates | 1988013..1988330 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M4269_RS09740 | Protein ID | WP_004142561.1 |
| Coordinates | 1987733..1988020 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4269_RS09710 (1983813) | 1983813..1984061 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| M4269_RS09715 (1984079) | 1984079..1984420 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M4269_RS09720 (1984451) | 1984451..1985566 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
| M4269_RS09725 (1985746) | 1985746..1986327 | + | 582 | WP_043906838.1 | TetR/AcrR family transcriptional regulator | - |
| M4269_RS09730 (1986327) | 1986327..1986695 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| M4269_RS09735 (1986815) | 1986815..1987465 | + | 651 | Protein_1918 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M4269_RS09740 (1987733) | 1987733..1988020 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M4269_RS09745 (1988013) | 1988013..1988330 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4269_RS09750 (1988515) | 1988515..1989558 | - | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
| M4269_RS09755 (1990225) | 1990225..1991091 | - | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
| M4269_RS09760 (1991200) | 1991200..1992627 | + | 1428 | WP_043906839.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T244987 WP_004142563.1 NZ_CP097232:c1988330-1988013 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |