Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3936568..3937154 Replicon chromosome
Accession NZ_CP097228
Organism Klebsiella pneumoniae strain 5

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M4270_RS18850 Protein ID WP_002920800.1
Coordinates 3936786..3937154 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M4270_RS18845 Protein ID WP_004174006.1
Coordinates 3936568..3936789 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4270_RS18825 (3932725) 3932725..3933651 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M4270_RS18830 (3933648) 3933648..3934925 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M4270_RS18835 (3934922) 3934922..3935689 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M4270_RS18840 (3935691) 3935691..3936404 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M4270_RS18845 (3936568) 3936568..3936789 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4270_RS18850 (3936786) 3936786..3937154 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M4270_RS18855 (3937427) 3937427..3938743 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M4270_RS18860 (3938850) 3938850..3939737 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M4270_RS18865 (3939734) 3939734..3940579 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M4270_RS18870 (3940581) 3940581..3941651 + 1071 WP_043906884.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3933648..3942388 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T244976 WP_002920800.1 NZ_CP097228:3936786-3937154 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT244976 WP_004174006.1 NZ_CP097228:3936568-3936789 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References