Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 2201505..2202102 | Replicon | chromosome |
Accession | NZ_CP097228 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | M4270_RS10760 | Protein ID | WP_004142563.1 |
Coordinates | 2201785..2202102 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | M4270_RS10755 | Protein ID | WP_004142561.1 |
Coordinates | 2201505..2201792 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS10725 (2197585) | 2197585..2197833 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
M4270_RS10730 (2197851) | 2197851..2198192 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
M4270_RS10735 (2198223) | 2198223..2199338 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
M4270_RS10740 (2199518) | 2199518..2200099 | + | 582 | WP_043906838.1 | TetR/AcrR family transcriptional regulator | - |
M4270_RS10745 (2200099) | 2200099..2200467 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
M4270_RS10750 (2200587) | 2200587..2201237 | + | 651 | Protein_2113 | oxygen-insensitive NAD(P)H nitroreductase | - |
M4270_RS10755 (2201505) | 2201505..2201792 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M4270_RS10760 (2201785) | 2201785..2202102 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4270_RS10765 (2202287) | 2202287..2203330 | - | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
M4270_RS10770 (2203997) | 2203997..2204863 | - | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
M4270_RS10775 (2204972) | 2204972..2206399 | + | 1428 | WP_043906839.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T244970 WP_004142563.1 NZ_CP097228:c2202102-2201785 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |