Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3942304..3942890 Replicon chromosome
Accession NZ_CP097223
Organism Klebsiella pneumoniae strain 11

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M4271_RS18875 Protein ID WP_002920800.1
Coordinates 3942522..3942890 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M4271_RS18870 Protein ID WP_004174006.1
Coordinates 3942304..3942525 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4271_RS18850 (3938461) 3938461..3939387 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M4271_RS18855 (3939384) 3939384..3940661 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M4271_RS18860 (3940658) 3940658..3941425 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M4271_RS18865 (3941427) 3941427..3942140 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M4271_RS18870 (3942304) 3942304..3942525 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4271_RS18875 (3942522) 3942522..3942890 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M4271_RS18880 (3943163) 3943163..3944479 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M4271_RS18885 (3944586) 3944586..3945473 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M4271_RS18890 (3945470) 3945470..3946315 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M4271_RS18895 (3946317) 3946317..3947387 + 1071 WP_043906884.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3939384..3948124 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T244959 WP_002920800.1 NZ_CP097223:3942522-3942890 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT244959 WP_004174006.1 NZ_CP097223:3942304-3942525 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References