Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 2207241..2207838 | Replicon | chromosome |
| Accession | NZ_CP097223 | ||
| Organism | Klebsiella pneumoniae strain 11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M4271_RS10785 | Protein ID | WP_004142563.1 |
| Coordinates | 2207521..2207838 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M4271_RS10780 | Protein ID | WP_004142561.1 |
| Coordinates | 2207241..2207528 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4271_RS10750 (2203321) | 2203321..2203569 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| M4271_RS10755 (2203587) | 2203587..2203928 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M4271_RS10760 (2203959) | 2203959..2205074 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
| M4271_RS10765 (2205254) | 2205254..2205835 | + | 582 | WP_043906838.1 | TetR/AcrR family transcriptional regulator | - |
| M4271_RS10770 (2205835) | 2205835..2206203 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| M4271_RS10775 (2206323) | 2206323..2206973 | + | 651 | Protein_2118 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M4271_RS10780 (2207241) | 2207241..2207528 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M4271_RS10785 (2207521) | 2207521..2207838 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4271_RS10790 (2208023) | 2208023..2209066 | - | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
| M4271_RS10795 (2209733) | 2209733..2210599 | - | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
| M4271_RS10800 (2210708) | 2210708..2212135 | + | 1428 | WP_043906839.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T244953 WP_004142563.1 NZ_CP097223:c2207838-2207521 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |