Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 3999455..4000041 | Replicon | chromosome |
Accession | NZ_CP097220 | ||
Organism | Klebsiella pneumoniae strain 12 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | M4272_RS19560 | Protein ID | WP_002920800.1 |
Coordinates | 3999455..3999823 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | M4272_RS19565 | Protein ID | WP_004174006.1 |
Coordinates | 3999820..4000041 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4272_RS19540 (3994958) | 3994958..3996028 | - | 1071 | WP_043906884.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
M4272_RS19545 (3996030) | 3996030..3996875 | - | 846 | WP_004181473.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
M4272_RS19550 (3996872) | 3996872..3997759 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
M4272_RS19555 (3997866) | 3997866..3999182 | - | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
M4272_RS19560 (3999455) | 3999455..3999823 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M4272_RS19565 (3999820) | 3999820..4000041 | - | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M4272_RS19570 (4000205) | 4000205..4000918 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
M4272_RS19575 (4000920) | 4000920..4001687 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
M4272_RS19580 (4001684) | 4001684..4002961 | - | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
M4272_RS19585 (4002958) | 4002958..4003884 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3994221..4002961 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T244940 WP_002920800.1 NZ_CP097220:c3999823-3999455 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E5YJY7 |