Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3999455..4000041 Replicon chromosome
Accession NZ_CP097220
Organism Klebsiella pneumoniae strain 12

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M4272_RS19560 Protein ID WP_002920800.1
Coordinates 3999455..3999823 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M4272_RS19565 Protein ID WP_004174006.1
Coordinates 3999820..4000041 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4272_RS19540 (3994958) 3994958..3996028 - 1071 WP_043906884.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
M4272_RS19545 (3996030) 3996030..3996875 - 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M4272_RS19550 (3996872) 3996872..3997759 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M4272_RS19555 (3997866) 3997866..3999182 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M4272_RS19560 (3999455) 3999455..3999823 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M4272_RS19565 (3999820) 3999820..4000041 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4272_RS19570 (4000205) 4000205..4000918 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M4272_RS19575 (4000920) 4000920..4001687 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M4272_RS19580 (4001684) 4001684..4002961 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M4272_RS19585 (4002958) 4002958..4003884 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3994221..4002961 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T244940 WP_002920800.1 NZ_CP097220:c3999823-3999455 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT244940 WP_004174006.1 NZ_CP097220:c4000041-3999820 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References