Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 389332..389929 | Replicon | chromosome |
| Accession | NZ_CP097220 | ||
| Organism | Klebsiella pneumoniae strain 12 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M4272_RS01880 | Protein ID | WP_004142563.1 |
| Coordinates | 389332..389649 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M4272_RS01885 | Protein ID | WP_004142561.1 |
| Coordinates | 389642..389929 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4272_RS01865 (385035) | 385035..386462 | - | 1428 | WP_043906839.1 | MFS transporter | - |
| M4272_RS01870 (386571) | 386571..387437 | + | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
| M4272_RS01875 (388104) | 388104..389147 | + | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
| M4272_RS01880 (389332) | 389332..389649 | + | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4272_RS01885 (389642) | 389642..389929 | + | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M4272_RS01890 (390197) | 390197..390847 | - | 651 | Protein_367 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M4272_RS01895 (390967) | 390967..391335 | - | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| M4272_RS01900 (391335) | 391335..391916 | - | 582 | WP_043906838.1 | TetR/AcrR family transcriptional regulator | - |
| M4272_RS01905 (392096) | 392096..393211 | + | 1116 | Protein_370 | MBL fold metallo-hydrolase | - |
| M4272_RS01910 (393242) | 393242..393583 | + | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M4272_RS01915 (393601) | 393601..393849 | - | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T244933 WP_004142563.1 NZ_CP097220:389332-389649 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |