Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3782732..3783426 | Replicon | chromosome |
Accession | NZ_CP097213 | ||
Organism | Escherichia coli strain BE311 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | M3O69_RS18360 | Protein ID | WP_001263489.1 |
Coordinates | 3782732..3783130 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | M3O69_RS18365 | Protein ID | WP_000554758.1 |
Coordinates | 3783133..3783426 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3778321) | 3778321..3778401 | - | 81 | NuclAT_11 | - | - |
- (3778321) | 3778321..3778401 | - | 81 | NuclAT_11 | - | - |
- (3778321) | 3778321..3778401 | - | 81 | NuclAT_11 | - | - |
- (3778321) | 3778321..3778401 | - | 81 | NuclAT_11 | - | - |
M3O69_RS18335 (3778997) | 3778997..3779455 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M3O69_RS18340 (3779716) | 3779716..3781173 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
M3O69_RS18345 (3781230) | 3781230..3781750 | - | 521 | Protein_3588 | peptide chain release factor H | - |
M3O69_RS18350 (3781746) | 3781746..3781952 | - | 207 | Protein_3589 | RtcB family protein | - |
M3O69_RS18355 (3782270) | 3782270..3782722 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
M3O69_RS18360 (3782732) | 3782732..3783130 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M3O69_RS18365 (3783133) | 3783133..3783426 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M3O69_RS18370 (3783478) | 3783478..3784533 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
M3O69_RS18375 (3784604) | 3784604..3785389 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
M3O69_RS18380 (3785361) | 3785361..3787073 | + | 1713 | Protein_3595 | flagellar biosynthesis protein FlhA | - |
M3O69_RS18385 (3787297) | 3787297..3787794 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T244920 WP_001263489.1 NZ_CP097213:c3783130-3782732 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |