Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2473382..2474020 | Replicon | chromosome |
Accession | NZ_CP097213 | ||
Organism | Escherichia coli strain BE311 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | M3O69_RS11945 | Protein ID | WP_001447010.1 |
Coordinates | 2473844..2474020 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M3O69_RS11940 | Protein ID | WP_001270286.1 |
Coordinates | 2473382..2473798 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3O69_RS11920 (2468534) | 2468534..2469475 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M3O69_RS11925 (2469476) | 2469476..2470489 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M3O69_RS11930 (2470507) | 2470507..2471652 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M3O69_RS11935 (2471897) | 2471897..2473303 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M3O69_RS11940 (2473382) | 2473382..2473798 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M3O69_RS11945 (2473844) | 2473844..2474020 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M3O69_RS11950 (2474242) | 2474242..2474472 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M3O69_RS11955 (2474564) | 2474564..2476525 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M3O69_RS11960 (2476598) | 2476598..2477134 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M3O69_RS11965 (2477226) | 2477226..2478401 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2478441..2479589 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T244918 WP_001447010.1 NZ_CP097213:c2474020-2473844 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT244918 WP_001270286.1 NZ_CP097213:c2473798-2473382 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|