Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3710065..3710759 | Replicon | chromosome |
| Accession | NZ_CP097181 | ||
| Organism | Escherichia coli strain SH21PTE31 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | M4R35_RS18240 | Protein ID | WP_001263493.1 |
| Coordinates | 3710065..3710463 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | M4R35_RS18245 | Protein ID | WP_000554757.1 |
| Coordinates | 3710466..3710759 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4R35_RS18210 (3705624) | 3705624..3706082 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| M4R35_RS18215 (3706343) | 3706343..3707800 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| M4R35_RS18220 (3707857) | 3707857..3708378 | - | 522 | Protein_3585 | peptide chain release factor H | - |
| M4R35_RS18225 (3708377) | 3708377..3708580 | - | 204 | Protein_3586 | RtcB family protein | - |
| M4R35_RS18230 (3708826) | 3708826..3709278 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| M4R35_RS18235 (3709352) | 3709352..3710049 | + | 698 | WP_223367350.1 | IS1 family transposase | - |
| M4R35_RS18240 (3710065) | 3710065..3710463 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M4R35_RS18245 (3710466) | 3710466..3710759 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M4R35_RS18250 (3710811) | 3710811..3711866 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| M4R35_RS18255 (3711937) | 3711937..3712722 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| M4R35_RS18260 (3712694) | 3712694..3714406 | + | 1713 | Protein_3593 | flagellar biosynthesis protein FlhA | - |
| M4R35_RS18265 (3714630) | 3714630..3715127 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3709756..3710049 | 293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T244875 WP_001263493.1 NZ_CP097181:c3710463-3710065 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|