Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2482777..2483415 | Replicon | chromosome |
Accession | NZ_CP097181 | ||
Organism | Escherichia coli strain SH21PTE31 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | M4R35_RS12145 | Protein ID | WP_000813794.1 |
Coordinates | 2483239..2483415 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M4R35_RS12140 | Protein ID | WP_001270286.1 |
Coordinates | 2482777..2483193 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4R35_RS12120 (2477929) | 2477929..2478870 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
M4R35_RS12125 (2478871) | 2478871..2479884 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
M4R35_RS12130 (2479902) | 2479902..2481047 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
M4R35_RS12135 (2481292) | 2481292..2482698 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
M4R35_RS12140 (2482777) | 2482777..2483193 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M4R35_RS12145 (2483239) | 2483239..2483415 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M4R35_RS12150 (2483637) | 2483637..2483867 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M4R35_RS12155 (2483959) | 2483959..2485920 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M4R35_RS12160 (2485993) | 2485993..2486529 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M4R35_RS12165 (2486621) | 2486621..2487796 | + | 1176 | WP_064670497.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 2487836..2488984 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T244873 WP_000813794.1 NZ_CP097181:c2483415-2483239 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT244873 WP_001270286.1 NZ_CP097181:c2483193-2482777 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|