Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 94089..94322 | Replicon | plasmid pAR13438_1 |
| Accession | NZ_CP097171 | ||
| Organism | Escherichia coli strain AR13438 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M3M51_RS24385 | Protein ID | WP_001372321.1 |
| Coordinates | 94089..94214 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 94291..94322 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M51_RS24340 (89135) | 89135..89362 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| M3M51_RS24345 (89456) | 89456..90142 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| M3M51_RS24350 (90333) | 90333..90716 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M3M51_RS24355 (90993) | 90993..91640 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| M3M51_RS24360 (91937) | 91937..92758 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| M3M51_RS24365 (92880) | 92880..93167 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| M3M51_RS24370 (93192) | 93192..93398 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| M3M51_RS24375 (93468) | 93468..93641 | + | 174 | Protein_114 | hypothetical protein | - |
| M3M51_RS24380 (93639) | 93639..93869 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| M3M51_RS24385 (94089) | 94089..94214 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M3M51_RS24390 (94156) | 94156..94305 | - | 150 | Protein_117 | plasmid maintenance protein Mok | - |
| - (94291) | 94291..94322 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (94291) | 94291..94322 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (94291) | 94291..94322 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (94291) | 94291..94322 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (95764) | 95764..95961 | - | 198 | NuclAT_0 | - | - |
| - (95764) | 95764..95961 | - | 198 | NuclAT_0 | - | - |
| - (95764) | 95764..95961 | - | 198 | NuclAT_0 | - | - |
| - (95764) | 95764..95961 | - | 198 | NuclAT_0 | - | - |
| M3M51_RS24400 (95773) | 95773..95961 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| M3M51_RS24405 (95930) | 95930..96692 | - | 763 | Protein_120 | plasmid SOS inhibition protein A | - |
| M3M51_RS24410 (96689) | 96689..97123 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| M3M51_RS24415 (97178) | 97178..99136 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / sul1 / rmtB / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / blaCTX-M-27 / mph(A) / sitABCD | - | 1..124392 | 124392 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T244854 WP_001372321.1 NZ_CP097171:c94214-94089 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT244854 NZ_CP097171:c94322-94291 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
