Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3729713..3730392 | Replicon | chromosome |
Accession | NZ_CP097170 | ||
Organism | Escherichia coli strain AR13438 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0A1A1R1 |
Locus tag | M3M51_RS17965 | Protein ID | WP_000057541.1 |
Coordinates | 3730090..3730392 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M3M51_RS17960 | Protein ID | WP_000806442.1 |
Coordinates | 3729713..3730054 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M51_RS17950 (3725956) | 3725956..3726888 | - | 933 | WP_000883039.1 | glutaminase A | - |
M3M51_RS17955 (3727151) | 3727151..3729655 | + | 2505 | WP_061092784.1 | copper-exporting P-type ATPase CopA | - |
M3M51_RS17960 (3729713) | 3729713..3730054 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M3M51_RS17965 (3730090) | 3730090..3730392 | - | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3M51_RS17970 (3730525) | 3730525..3731319 | + | 795 | WP_000365157.1 | TraB/GumN family protein | - |
M3M51_RS17975 (3731523) | 3731523..3732002 | + | 480 | WP_000186626.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M3M51_RS17980 (3732039) | 3732039..3733691 | - | 1653 | WP_000771723.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
M3M51_RS17985 (3733909) | 3733909..3735129 | + | 1221 | WP_001251634.1 | fosmidomycin MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T244845 WP_000057541.1 NZ_CP097170:c3730392-3730090 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1A1R1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2EBY | |
AlphaFold DB | S1QAY3 |