Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-YefM
Location 2524547..2525052 Replicon chromosome
Accession NZ_CP097127
Organism Conexibacter sp. S30A1

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag M3M54_RS12175 Protein ID WP_249019316.1
Coordinates 2524547..2524807 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag M3M54_RS12180 Protein ID WP_256465778.1
Coordinates 2524804..2525052 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3M54_RS12140 2519991..2520335 + 345 WP_249019309.1 hypothetical protein -
M3M54_RS12145 2520322..2520600 + 279 WP_249019310.1 hypothetical protein -
M3M54_RS12150 2520707..2521108 - 402 WP_249019311.1 PIN domain-containing protein -
M3M54_RS12155 2521105..2521329 - 225 WP_249019312.1 ribbon-helix-helix protein, CopG family -
M3M54_RS12160 2521554..2522741 + 1188 WP_249019313.1 LanC-like protein -
M3M54_RS12165 2523052..2523801 - 750 WP_249019314.1 methyltransferase domain-containing protein -
M3M54_RS12170 2524010..2524492 - 483 WP_249019315.1 GNAT family N-acetyltransferase -
M3M54_RS12175 2524547..2524807 - 261 WP_249019316.1 Txe/YoeB family addiction module toxin Toxin
M3M54_RS12180 2524804..2525052 - 249 WP_256465778.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
M3M54_RS12185 2525237..2525536 - 300 WP_249019317.1 hypothetical protein -
M3M54_RS12190 2525594..2525782 - 189 WP_249019318.1 hypothetical protein -
M3M54_RS12195 2526081..2526419 + 339 WP_249019319.1 helix-turn-helix transcriptional regulator -
M3M54_RS12200 2526416..2527141 + 726 WP_249019320.1 hypothetical protein -
M3M54_RS12205 2527144..2527491 + 348 WP_249019321.1 hypothetical protein -
M3M54_RS12210 2527745..2528005 - 261 WP_249019322.1 hypothetical protein -
M3M54_RS12215 2528267..2529049 - 783 WP_249019323.1 ABC transporter permease subunit -
M3M54_RS12220 2529046..2529945 - 900 WP_249019324.1 ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2516851..2529049 12198


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-72)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10267.67 Da        Isoelectric Point: 9.4587

>T244813 WP_249019316.1 NZ_CP097127:c2524807-2524547 [Conexibacter sp. S30A1]
VRLVFTPQGWDDYCHWQQSDRSILKRINRLIDDALRDPTSGIGKPEPLKYGITGTWSRRITDEHRLVYRVLNDDLVILQA
RYHYQK

Download         Length: 261 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9164.26 Da        Isoelectric Point: 4.6536

>AT244813 WP_256465778.1 NZ_CP097127:c2525052-2524804 [Conexibacter sp. S30A1]
MAITASEARRALFPLIEKVNDDRTAIEITSKRGNAVLMAAEDYAAWQETAYLFRSPANARRLLDAAEAAERGEFAEHPLD
RE

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References