Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 1173733..1174255 | Replicon | chromosome |
Accession | NZ_CP097121 | ||
Organism | Fructilactobacillus carniphilus strain KI4_A6 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | M3M37_RS05915 | Protein ID | WP_252766489.1 |
Coordinates | 1173733..1174011 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | M3M37_RS05920 | Protein ID | WP_252766490.1 |
Coordinates | 1174004..1174255 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M37_RS05890 (M3M37_05890) | 1169846..1170346 | + | 501 | WP_252794894.1 | hypothetical protein | - |
M3M37_RS05895 (M3M37_05895) | 1170395..1171087 | - | 693 | WP_252794895.1 | hypothetical protein | - |
M3M37_RS05900 (M3M37_05900) | 1171047..1172516 | - | 1470 | WP_252794896.1 | DUF1906 domain-containing protein | - |
M3M37_RS05905 (M3M37_05905) | 1172767..1173084 | + | 318 | WP_252794897.1 | helix-turn-helix transcriptional regulator | - |
M3M37_RS05910 (M3M37_05910) | 1173065..1173475 | + | 411 | WP_252794898.1 | ImmA/IrrE family metallo-endopeptidase | - |
M3M37_RS05915 (M3M37_05915) | 1173733..1174011 | - | 279 | WP_252766489.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
M3M37_RS05920 (M3M37_05920) | 1174004..1174255 | - | 252 | WP_252766490.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3M37_RS05925 (M3M37_05925) | 1175083..1175814 | - | 732 | WP_252794899.1 | LysM peptidoglycan-binding domain-containing protein | - |
M3M37_RS05930 (M3M37_05930) | 1176085..1177776 | - | 1692 | WP_252794900.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11401.97 Da Isoelectric Point: 8.3471
>T244802 WP_252766489.1 NZ_CP097121:c1174011-1173733 [Fructilactobacillus carniphilus]
MTKQYKPAFENQFKKHYKQMLKQPKYNKNQFNEIYYLLINDEEIPAKFNDHNLINRKPERELHIKPDWLLIYRYDGDYIK
FIDTGSHSDLFE
MTKQYKPAFENQFKKHYKQMLKQPKYNKNQFNEIYYLLINDEEIPAKFNDHNLINRKPERELHIKPDWLLIYRYDGDYIK
FIDTGSHSDLFE
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|