Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
Location | 1094953..1095475 | Replicon | chromosome |
Accession | NZ_CP097119 | ||
Organism | Fructilactobacillus cliffordii strain KI4_B1 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | - |
Locus tag | M3M40_RS05655 | Protein ID | WP_252766489.1 |
Coordinates | 1094953..1095231 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | M3M40_RS05660 | Protein ID | WP_252766490.1 |
Coordinates | 1095224..1095475 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M40_RS05625 (M3M40_05625) | 1090068..1090268 | + | 201 | WP_252766483.1 | helix-turn-helix transcriptional regulator | - |
M3M40_RS05630 (M3M40_05630) | 1090359..1090769 | + | 411 | WP_252766484.1 | ImmA/IrrE family metallo-endopeptidase | - |
M3M40_RS05635 (M3M40_05635) | 1091030..1091392 | - | 363 | WP_252766485.1 | hypothetical protein | - |
M3M40_RS05640 (M3M40_05640) | 1091586..1093736 | - | 2151 | WP_252766486.1 | DUF1906 domain-containing protein | - |
M3M40_RS05645 (M3M40_05645) | 1093987..1094304 | + | 318 | WP_252766487.1 | helix-turn-helix transcriptional regulator | - |
M3M40_RS05650 (M3M40_05650) | 1094285..1094695 | + | 411 | WP_252766488.1 | ImmA/IrrE family metallo-endopeptidase | - |
M3M40_RS05655 (M3M40_05655) | 1094953..1095231 | - | 279 | WP_252766489.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
M3M40_RS05660 (M3M40_05660) | 1095224..1095475 | - | 252 | WP_252766490.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3M40_RS05665 (M3M40_05665) | 1096305..1097036 | - | 732 | WP_252766491.1 | LysM domain-containing protein | - |
M3M40_RS05670 (M3M40_05670) | 1097308..1098999 | - | 1692 | WP_252766492.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1088511..1104287 | 15776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11401.97 Da Isoelectric Point: 8.3471
>T244801 WP_252766489.1 NZ_CP097119:c1095231-1094953 [Fructilactobacillus cliffordii]
MTKQYKPAFENQFKKHYKQMLKQPKYNKNQFNEIYYLLINDEEIPAKFNDHNLINRKPERELHIKPDWLLIYRYDGDYIK
FIDTGSHSDLFE
MTKQYKPAFENQFKKHYKQMLKQPKYNKNQFNEIYYLLINDEEIPAKFNDHNLINRKPERELHIKPDWLLIYRYDGDYIK
FIDTGSHSDLFE
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|