Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 807804..808326 | Replicon | chromosome |
| Accession | NZ_CP097117 | ||
| Organism | Fructilactobacillus cliffordii strain KI11_D11 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | - |
| Locus tag | M3M38_RS04060 | Protein ID | WP_252766489.1 |
| Coordinates | 807804..808082 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | M3M38_RS04065 | Protein ID | WP_252766490.1 |
| Coordinates | 808075..808326 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3M38_RS04040 (M3M38_04040) | 803903..804436 | + | 534 | WP_252813633.1 | hypothetical protein | - |
| M3M38_RS04045 (M3M38_04045) | 804437..806587 | - | 2151 | WP_252813634.1 | DUF1906 domain-containing protein | - |
| M3M38_RS04050 (M3M38_04050) | 806838..807155 | + | 318 | WP_252797366.1 | helix-turn-helix transcriptional regulator | - |
| M3M38_RS04055 (M3M38_04055) | 807136..807546 | + | 411 | WP_252766488.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M3M38_RS04060 (M3M38_04060) | 807804..808082 | - | 279 | WP_252766489.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| M3M38_RS04065 (M3M38_04065) | 808075..808326 | - | 252 | WP_252766490.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M3M38_RS04070 (M3M38_04070) | 809148..809879 | - | 732 | WP_252813635.1 | LysM domain-containing protein | - |
| M3M38_RS04075 (M3M38_04075) | 810151..811842 | - | 1692 | WP_252813636.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11401.97 Da Isoelectric Point: 8.3471
>T244800 WP_252766489.1 NZ_CP097117:c808082-807804 [Fructilactobacillus cliffordii]
MTKQYKPAFENQFKKHYKQMLKQPKYNKNQFNEIYYLLINDEEIPAKFNDHNLINRKPERELHIKPDWLLIYRYDGDYIK
FIDTGSHSDLFE
MTKQYKPAFENQFKKHYKQMLKQPKYNKNQFNEIYYLLINDEEIPAKFNDHNLINRKPERELHIKPDWLLIYRYDGDYIK
FIDTGSHSDLFE
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|