Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 6284474..6285146 | Replicon | chromosome |
Accession | NZ_CP097108 | ||
Organism | Pseudomonas bijieensis strain SP1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M3M50_RS27930 | Protein ID | WP_109754987.1 |
Coordinates | 6284781..6285146 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M3M50_RS27925 | Protein ID | WP_109754986.1 |
Coordinates | 6284474..6284788 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M50_RS27915 (M3M50_27915) | 6281521..6283953 | + | 2433 | WP_249015642.1 | DUF308 domain-containing protein | - |
M3M50_RS27920 (M3M50_27920) | 6283990..6284451 | + | 462 | WP_018607342.1 | Lrp/AsnC family transcriptional regulator | - |
M3M50_RS27925 (M3M50_27925) | 6284474..6284788 | - | 315 | WP_109754986.1 | XRE family transcriptional regulator | Antitoxin |
M3M50_RS27930 (M3M50_27930) | 6284781..6285146 | - | 366 | WP_109754987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3M50_RS27935 (M3M50_27935) | 6285507..6287189 | + | 1683 | WP_249015643.1 | NAD(P)/FAD-dependent oxidoreductase | - |
M3M50_RS27940 (M3M50_27940) | 6287202..6287996 | + | 795 | WP_109754989.1 | carbon-nitrogen hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14013.68 Da Isoelectric Point: 4.9669
>T244799 WP_109754987.1 NZ_CP097108:c6285146-6284781 [Pseudomonas bijieensis]
MKWDVEYTDEFEMWWSCLSETEQDSVQASVMLLGDAGPHLGFPHTSDIKGSRHGNLRELRVQHAGRPYRVLYAFDPRRCA
ILLIGGDKTGQDRWYQECVPLAERLYDEHLEALKREGFDNG
MKWDVEYTDEFEMWWSCLSETEQDSVQASVMLLGDAGPHLGFPHTSDIKGSRHGNLRELRVQHAGRPYRVLYAFDPRRCA
ILLIGGDKTGQDRWYQECVPLAERLYDEHLEALKREGFDNG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|