Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 5712531..5713186 | Replicon | chromosome |
Accession | NZ_CP097108 | ||
Organism | Pseudomonas bijieensis strain SP1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M3M50_RS25235 | Protein ID | WP_109754833.1 |
Coordinates | 5712842..5713186 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M3M50_RS25230 | Protein ID | WP_003205391.1 |
Coordinates | 5712531..5712845 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M50_RS25210 (M3M50_25210) | 5708440..5709357 | + | 918 | WP_249015535.1 | LysR family transcriptional regulator | - |
M3M50_RS25215 (M3M50_25215) | 5709601..5710614 | + | 1014 | WP_109754830.1 | sensor domain-containing diguanylate cyclase | - |
M3M50_RS25220 (M3M50_25220) | 5710707..5711450 | + | 744 | WP_249015536.1 | DUF72 domain-containing protein | - |
M3M50_RS25225 (M3M50_25225) | 5711589..5712293 | + | 705 | WP_109754832.1 | hypothetical protein | - |
M3M50_RS25230 (M3M50_25230) | 5712531..5712845 | - | 315 | WP_003205391.1 | helix-turn-helix domain-containing protein | Antitoxin |
M3M50_RS25235 (M3M50_25235) | 5712842..5713186 | - | 345 | WP_109754833.1 | toxin | Toxin |
M3M50_RS25240 (M3M50_25240) | 5713326..5714213 | - | 888 | WP_109754834.1 | heme o synthase | - |
M3M50_RS25245 (M3M50_25245) | 5714225..5714560 | - | 336 | WP_025211927.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M3M50_RS25250 (M3M50_25250) | 5714561..5715187 | - | 627 | WP_109754835.1 | cytochrome o ubiquinol oxidase subunit III | - |
M3M50_RS25255 (M3M50_25255) | 5715191..5717221 | - | 2031 | WP_109754836.1 | cytochrome o ubiquinol oxidase subunit I | - |
M3M50_RS25260 (M3M50_25260) | 5717225..5718172 | - | 948 | WP_003205397.1 | ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13680.71 Da Isoelectric Point: 9.2887
>T244798 WP_109754833.1 NZ_CP097108:c5713186-5712842 [Pseudomonas bijieensis]
MRTLFFETTTFTATVGHYLTDDEYRLLQSYMLEHPEVGDVMPRTGGFRKLRWFDERRGKGKRGGLRVIYYWLMNDRQFWM
FAIYDKDELVNLTSEQEKTLKRAIEAELKVRGTL
MRTLFFETTTFTATVGHYLTDDEYRLLQSYMLEHPEVGDVMPRTGGFRKLRWFDERRGKGKRGGLRVIYYWLMNDRQFWM
FAIYDKDELVNLTSEQEKTLKRAIEAELKVRGTL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|