Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2379088..2379692 | Replicon | chromosome |
Accession | NZ_CP097108 | ||
Organism | Pseudomonas bijieensis strain SP1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M3M50_RS10425 | Protein ID | WP_116831887.1 |
Coordinates | 2379378..2379692 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6N1CCA5 |
Locus tag | M3M50_RS10420 | Protein ID | WP_058545613.1 |
Coordinates | 2379088..2379375 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M50_RS10395 (M3M50_10395) | 2375145..2376194 | + | 1050 | WP_249016166.1 | NAD(P)-dependent alcohol dehydrogenase | - |
M3M50_RS10400 (M3M50_10400) | 2376321..2377538 | + | 1218 | WP_176688261.1 | MFS transporter | - |
M3M50_RS10405 (M3M50_10405) | 2377550..2377957 | - | 408 | WP_163854612.1 | DoxX family protein | - |
M3M50_RS10410 (M3M50_10410) | 2378015..2378443 | + | 429 | WP_233459536.1 | helix-turn-helix domain-containing protein | - |
M3M50_RS10415 (M3M50_10415) | 2378459..2378944 | - | 486 | WP_176688260.1 | hypothetical protein | - |
M3M50_RS10420 (M3M50_10420) | 2379088..2379375 | - | 288 | WP_058545613.1 | helix-turn-helix domain-containing protein | Antitoxin |
M3M50_RS10425 (M3M50_10425) | 2379378..2379692 | - | 315 | WP_116831887.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3M50_RS10430 (M3M50_10430) | 2379823..2380254 | + | 432 | WP_116831888.1 | arsenic resistance N-acetyltransferase ArsN2 | - |
M3M50_RS10435 (M3M50_10435) | 2380251..2381609 | - | 1359 | WP_109751620.1 | chromate efflux transporter | - |
M3M50_RS10440 (M3M50_10440) | 2381788..2382447 | + | 660 | WP_116831889.1 | ribonuclease T2 | - |
M3M50_RS10445 (M3M50_10445) | 2382659..2384230 | + | 1572 | WP_212802157.1 | GGDEF domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11934.03 Da Isoelectric Point: 10.1359
>T244797 WP_116831887.1 NZ_CP097108:c2379692-2379378 [Pseudomonas bijieensis]
MIFIETPIFTRRVKELMDDDDFAVLQKILVCNPSAGDVMEATGGIRKIRIAAKGHGKRGGARVIYYHFVHASRIALLMIY
PKNEQQDLTVDQRKALKLIVEHWR
MIFIETPIFTRRVKELMDDDDFAVLQKILVCNPSAGDVMEATGGIRKIRIAAKGHGKRGGARVIYYHFVHASRIALLMIY
PKNEQQDLTVDQRKALKLIVEHWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|