Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1244638..1245224 | Replicon | chromosome |
| Accession | NZ_CP097103 | ||
| Organism | Pseudomonas sp. NY11382 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | A0A6I2K6L8 |
| Locus tag | M2J80_RS05665 | Protein ID | WP_029885077.1 |
| Coordinates | 1244946..1245224 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | M2J80_RS05660 | Protein ID | WP_029885078.1 |
| Coordinates | 1244638..1244937 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J80_RS05635 (M2J80_05620) | 1240524..1241333 | + | 810 | WP_161891667.1 | tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA | - |
| M2J80_RS05640 (M2J80_05625) | 1241405..1241815 | - | 411 | WP_161891668.1 | SufE family protein | - |
| M2J80_RS05645 (M2J80_05630) | 1241812..1243017 | - | 1206 | WP_161891669.1 | cysteine desulfurase | - |
| M2J80_RS05650 (M2J80_05635) | 1243099..1244133 | - | 1035 | WP_009686960.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
| M2J80_RS05655 (M2J80_05640) | 1244165..1244512 | - | 348 | WP_054881204.1 | ArsC family reductase | - |
| M2J80_RS05660 (M2J80_05645) | 1244638..1244937 | - | 300 | WP_029885078.1 | type II toxin-antitoxin system antitoxin GraA | Antitoxin |
| M2J80_RS05665 (M2J80_05650) | 1244946..1245224 | - | 279 | WP_029885077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2J80_RS05670 (M2J80_05655) | 1245473..1247119 | + | 1647 | WP_054890073.1 | Na+/H+ antiporter | - |
| M2J80_RS05675 (M2J80_05660) | 1248158..1249354 | - | 1197 | WP_110678255.1 | succinyldiaminopimelate transaminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10420.72 Da Isoelectric Point: 7.1344
>T244779 WP_029885077.1 NZ_CP097103:c1245224-1244946 [Pseudomonas sp. NY11382]
MIQSFSCADTEALFVTGKTRRWSDIKSVAERKLAMLDAATELRDLRSPPGNRLEALSGNRAGQHSIRVNDQWRLCFTWTD
NGPANVEIIDYH
MIQSFSCADTEALFVTGKTRRWSDIKSVAERKLAMLDAATELRDLRSPPGNRLEALSGNRAGQHSIRVNDQWRLCFTWTD
NGPANVEIIDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|