Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 48617..48871 Replicon plasmid pEC258-1
Accession NZ_CP097096
Organism Escherichia coli strain 258E

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag HPY99_RS22915 Protein ID WP_001312851.1
Coordinates 48722..48871 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 48617..48678 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HPY99_RS22890 (45365) 45365..46111 + 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -
HPY99_RS22895 (46170) 46170..47030 + 861 WP_249232969.1 alpha/beta hydrolase -
HPY99_RS22900 (47133) 47133..47693 + 561 WP_000139315.1 fertility inhibition protein FinO -
HPY99_RS22905 (47829) 47829..48041 + 213 WP_001299730.1 ANR family transcriptional regulator -
HPY99_RS22910 (48287) 48287..48361 + 75 Protein_65 endonuclease -
- (48617) 48617..48678 - 62 NuclAT_1 - Antitoxin
- (48617) 48617..48678 - 62 NuclAT_1 - Antitoxin
- (48617) 48617..48678 - 62 NuclAT_1 - Antitoxin
- (48617) 48617..48678 - 62 NuclAT_1 - Antitoxin
HPY99_RS22915 (48722) 48722..48871 + 150 WP_001312851.1 Hok/Gef family protein Toxin
HPY99_RS22920 (49155) 49155..49412 + 258 WP_000083845.1 replication regulatory protein RepA -
HPY99_RS22925 (49429) 49429..49680 - 252 WP_223195197.1 replication protein RepA -
HPY99_RS22930 (49671) 49671..49718 + 48 WP_229471593.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..50185 50185


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T244772 WP_001312851.1 NZ_CP097096:48722-48871 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT244772 NZ_CP097096:c48678-48617 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References