Detailed information of TA system TA244768

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 10116..10542
• Replicon: plasmid pEC258-1
• Accession: NZ_CP097096
• Organism: Escherichia coli strain 258E

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: HPY99_RS22680
• Protein ID: WP_001372321.1
• Coordinates: 10417..10542 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	10116..10340 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HPY99_RS22625 (5535)	5535..6506	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
HPY99_RS22630 (7100)	7100..7269	+	170	Protein_9	hypothetical protein	-
HPY99_RS22635 (7452)	7452..7532	-	81	Protein_10	hypothetical protein	-
HPY99_RS22640 (7602)	7602..7808	+	207	WP_000275856.1	hypothetical protein	-
HPY99_RS22645 (7834)	7834..8373	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
HPY99_RS22650 (8441)	8441..8674	+	234	WP_000005987.1	DUF905 family protein	-
HPY99_RS22655 (8702)	8702..8899	+	198	Protein_14	hypothetical protein	-
HPY99_RS22660 (8954)	8954..9388	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
HPY99_RS22665 (9385)	9385..10147	+	763	Protein_16	plasmid SOS inhibition protein A	-
HPY99_RS22670 (10116)	10116..10304	-	189	WP_001299721.1	hypothetical protein	-
- (10116)	10116..10340	+	225	NuclAT_0	-	Antitoxin
- (10116)	10116..10340	+	225	NuclAT_0	-	Antitoxin
- (10116)	10116..10340	+	225	NuclAT_0	-	Antitoxin
- (10116)	10116..10340	+	225	NuclAT_0	-	Antitoxin
HPY99_RS22675 (10326)	10326..10475	+	150	Protein_18	plasmid maintenance protein Mok	-
HPY99_RS22680 (10417)	10417..10542	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
HPY99_RS22685 (10762)	10762..10992	+	231	WP_071586998.1	hypothetical protein	-
HPY99_RS22690 (10990)	10990..11162	-	173	Protein_21	hypothetical protein	-
HPY99_RS22695 (11232)	11232..11438	+	207	WP_000547968.1	hypothetical protein	-
HPY99_RS22700 (11463)	11463..11750	+	288	WP_000107535.1	hypothetical protein	-
HPY99_RS22705 (11868)	11868..12689	+	822	WP_001234426.1	DUF932 domain-containing protein	-
HPY99_RS22710 (12986)	12986..13576	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
HPY99_RS22715 (13909)	13909..14292	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
HPY99_RS22720 (14479)	14479..15168	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..50185	50185

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T244768 WP_001372321.1 NZ_CP097096:10417-10542 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT244768 NZ_CP097096:10116-10340 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin