Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 326511..327097 Replicon chromosome
Accession NZ_CP097082
Organism Klebsiella pneumoniae strain KP130

Toxin (Protein)


Gene name doc Uniprot ID A0A486RB10
Locus tag M3I82_RS01515 Protein ID WP_004174007.1
Coordinates 326729..327097 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M3I82_RS01510 Protein ID WP_004174006.1
Coordinates 326511..326732 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I82_RS01490 (322668) 322668..323594 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M3I82_RS01495 (323591) 323591..324868 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M3I82_RS01500 (324865) 324865..325632 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M3I82_RS01505 (325634) 325634..326347 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M3I82_RS01510 (326511) 326511..326732 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M3I82_RS01515 (326729) 326729..327097 + 369 WP_004174007.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M3I82_RS01520 (327370) 327370..328686 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M3I82_RS01525 (328793) 328793..329680 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M3I82_RS01530 (329677) 329677..330522 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M3I82_RS01535 (330524) 330524..331594 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 323591..332331 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T244749 WP_004174007.1 NZ_CP097082:326729-327097 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDLGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT244749 WP_004174006.1 NZ_CP097082:326511-326732 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486RB10

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References