Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 1275579..1275800 Replicon chromosome
Accession NC_013654
Organism Escherichia coli SE15

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag ECSF_RS06330 Protein ID WP_001531632.1
Coordinates 1275579..1275686 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 1275734..1275800 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECSF_RS06305 1271423..1272505 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECSF_RS06310 1272505..1273338 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECSF_RS06315 1273335..1273727 + 393 WP_000200375.1 invasion regulator SirB2 -
ECSF_RS06320 1273731..1274540 + 810 WP_001257044.1 invasion regulator SirB1 -
ECSF_RS06325 1274576..1275430 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECSF_RS06330 1275579..1275686 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1275734..1275800 + 67 NuclAT_10 - Antitoxin
- 1275734..1275800 + 67 NuclAT_10 - Antitoxin
- 1275734..1275800 + 67 NuclAT_10 - Antitoxin
- 1275734..1275800 + 67 NuclAT_10 - Antitoxin
- 1275734..1275800 + 67 NuclAT_11 - Antitoxin
- 1275734..1275800 + 67 NuclAT_11 - Antitoxin
- 1275734..1275800 + 67 NuclAT_11 - Antitoxin
- 1275734..1275800 + 67 NuclAT_11 - Antitoxin
- 1275734..1275800 + 67 NuclAT_12 - Antitoxin
- 1275734..1275800 + 67 NuclAT_12 - Antitoxin
- 1275734..1275800 + 67 NuclAT_12 - Antitoxin
- 1275734..1275800 + 67 NuclAT_12 - Antitoxin
- 1275734..1275800 + 67 NuclAT_7 - Antitoxin
- 1275734..1275800 + 67 NuclAT_7 - Antitoxin
- 1275734..1275800 + 67 NuclAT_7 - Antitoxin
- 1275734..1275800 + 67 NuclAT_7 - Antitoxin
- 1275734..1275800 + 67 NuclAT_8 - Antitoxin
- 1275734..1275800 + 67 NuclAT_8 - Antitoxin
- 1275734..1275800 + 67 NuclAT_8 - Antitoxin
- 1275734..1275800 + 67 NuclAT_8 - Antitoxin
- 1275734..1275800 + 67 NuclAT_9 - Antitoxin
- 1275734..1275800 + 67 NuclAT_9 - Antitoxin
- 1275734..1275800 + 67 NuclAT_9 - Antitoxin
- 1275734..1275800 + 67 NuclAT_9 - Antitoxin
- 1275736..1275799 + 64 NuclAT_14 - -
- 1275736..1275799 + 64 NuclAT_14 - -
- 1275736..1275799 + 64 NuclAT_14 - -
- 1275736..1275799 + 64 NuclAT_14 - -
- 1275736..1275799 + 64 NuclAT_15 - -
- 1275736..1275799 + 64 NuclAT_15 - -
- 1275736..1275799 + 64 NuclAT_15 - -
- 1275736..1275799 + 64 NuclAT_15 - -
- 1275736..1275799 + 64 NuclAT_16 - -
- 1275736..1275799 + 64 NuclAT_16 - -
- 1275736..1275799 + 64 NuclAT_16 - -
- 1275736..1275799 + 64 NuclAT_16 - -
- 1275736..1275799 + 64 NuclAT_17 - -
- 1275736..1275799 + 64 NuclAT_17 - -
- 1275736..1275799 + 64 NuclAT_17 - -
- 1275736..1275799 + 64 NuclAT_17 - -
- 1275736..1275799 + 64 NuclAT_18 - -
- 1275736..1275799 + 64 NuclAT_18 - -
- 1275736..1275799 + 64 NuclAT_18 - -
- 1275736..1275799 + 64 NuclAT_18 - -
- 1275736..1275799 + 64 NuclAT_19 - -
- 1275736..1275799 + 64 NuclAT_19 - -
- 1275736..1275799 + 64 NuclAT_19 - -
- 1275736..1275799 + 64 NuclAT_19 - -
- 1275736..1275801 + 66 NuclAT_20 - -
- 1275736..1275801 + 66 NuclAT_20 - -
- 1275736..1275801 + 66 NuclAT_20 - -
- 1275736..1275801 + 66 NuclAT_20 - -
- 1275736..1275801 + 66 NuclAT_21 - -
- 1275736..1275801 + 66 NuclAT_21 - -
- 1275736..1275801 + 66 NuclAT_21 - -
- 1275736..1275801 + 66 NuclAT_21 - -
- 1275736..1275801 + 66 NuclAT_22 - -
- 1275736..1275801 + 66 NuclAT_22 - -
- 1275736..1275801 + 66 NuclAT_22 - -
- 1275736..1275801 + 66 NuclAT_22 - -
- 1275736..1275801 + 66 NuclAT_23 - -
- 1275736..1275801 + 66 NuclAT_23 - -
- 1275736..1275801 + 66 NuclAT_23 - -
- 1275736..1275801 + 66 NuclAT_23 - -
- 1275736..1275801 + 66 NuclAT_24 - -
- 1275736..1275801 + 66 NuclAT_24 - -
- 1275736..1275801 + 66 NuclAT_24 - -
- 1275736..1275801 + 66 NuclAT_24 - -
- 1275736..1275801 + 66 NuclAT_25 - -
- 1275736..1275801 + 66 NuclAT_25 - -
- 1275736..1275801 + 66 NuclAT_25 - -
- 1275736..1275801 + 66 NuclAT_25 - -
ECSF_RS06335 1276091..1277191 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
ECSF_RS06340 1277461..1277700 + 240 WP_000120702.1 putative cation transport regulator ChaB -
ECSF_RS06345 1277849..1278544 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
ECSF_RS06350 1278588..1278941 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
ECSF_RS06355 1279126..1280520 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T24472 WP_001531632.1 NC_013654:c1275686-1275579 [Escherichia coli SE15]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T24472 NC_013654:c1275686-1275579 [Escherichia coli SE15]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT24472 NC_013654:1275734-1275800 [Escherichia coli SE15]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References