Detailed information of TA system TA024472

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-timR/Ldr(toxin)
• Location: 1275579..1275800
• Replicon: chromosome
• Accession: NC_013654
• Organism: Escherichia coli SE15

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: ECSF_RS06330
• Protein ID: WP_001531632.1
• Coordinates: 1275579..1275686 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	timR
Locus tag	-
Coordinates	1275734..1275800 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECSF_RS06305	1271423..1272505	+	1083	WP_000804726.1	peptide chain release factor 1	-
ECSF_RS06310	1272505..1273338	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
ECSF_RS06315	1273335..1273727	+	393	WP_000200375.1	invasion regulator SirB2	-
ECSF_RS06320	1273731..1274540	+	810	WP_001257044.1	invasion regulator SirB1	-
ECSF_RS06325	1274576..1275430	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
ECSF_RS06330	1275579..1275686	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1275734..1275800	+	67	NuclAT_10	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_10	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_10	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_10	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_11	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_11	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_11	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_11	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_12	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_12	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_12	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_12	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_7	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_7	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_7	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_7	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_8	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_8	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_8	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_8	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_9	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_9	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_9	-	Antitoxin
-	1275734..1275800	+	67	NuclAT_9	-	Antitoxin
-	1275736..1275799	+	64	NuclAT_14	-	-
-	1275736..1275799	+	64	NuclAT_14	-	-
-	1275736..1275799	+	64	NuclAT_14	-	-
-	1275736..1275799	+	64	NuclAT_14	-	-
-	1275736..1275799	+	64	NuclAT_15	-	-
-	1275736..1275799	+	64	NuclAT_15	-	-
-	1275736..1275799	+	64	NuclAT_15	-	-
-	1275736..1275799	+	64	NuclAT_15	-	-
-	1275736..1275799	+	64	NuclAT_16	-	-
-	1275736..1275799	+	64	NuclAT_16	-	-
-	1275736..1275799	+	64	NuclAT_16	-	-
-	1275736..1275799	+	64	NuclAT_16	-	-
-	1275736..1275799	+	64	NuclAT_17	-	-
-	1275736..1275799	+	64	NuclAT_17	-	-
-	1275736..1275799	+	64	NuclAT_17	-	-
-	1275736..1275799	+	64	NuclAT_17	-	-
-	1275736..1275799	+	64	NuclAT_18	-	-
-	1275736..1275799	+	64	NuclAT_18	-	-
-	1275736..1275799	+	64	NuclAT_18	-	-
-	1275736..1275799	+	64	NuclAT_18	-	-
-	1275736..1275799	+	64	NuclAT_19	-	-
-	1275736..1275799	+	64	NuclAT_19	-	-
-	1275736..1275799	+	64	NuclAT_19	-	-
-	1275736..1275799	+	64	NuclAT_19	-	-
-	1275736..1275801	+	66	NuclAT_20	-	-
-	1275736..1275801	+	66	NuclAT_20	-	-
-	1275736..1275801	+	66	NuclAT_20	-	-
-	1275736..1275801	+	66	NuclAT_20	-	-
-	1275736..1275801	+	66	NuclAT_21	-	-
-	1275736..1275801	+	66	NuclAT_21	-	-
-	1275736..1275801	+	66	NuclAT_21	-	-
-	1275736..1275801	+	66	NuclAT_21	-	-
-	1275736..1275801	+	66	NuclAT_22	-	-
-	1275736..1275801	+	66	NuclAT_22	-	-
-	1275736..1275801	+	66	NuclAT_22	-	-
-	1275736..1275801	+	66	NuclAT_22	-	-
-	1275736..1275801	+	66	NuclAT_23	-	-
-	1275736..1275801	+	66	NuclAT_23	-	-
-	1275736..1275801	+	66	NuclAT_23	-	-
-	1275736..1275801	+	66	NuclAT_23	-	-
-	1275736..1275801	+	66	NuclAT_24	-	-
-	1275736..1275801	+	66	NuclAT_24	-	-
-	1275736..1275801	+	66	NuclAT_24	-	-
-	1275736..1275801	+	66	NuclAT_24	-	-
-	1275736..1275801	+	66	NuclAT_25	-	-
-	1275736..1275801	+	66	NuclAT_25	-	-
-	1275736..1275801	+	66	NuclAT_25	-	-
-	1275736..1275801	+	66	NuclAT_25	-	-
ECSF_RS06335	1276091..1277191	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
ECSF_RS06340	1277461..1277700	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
ECSF_RS06345	1277849..1278544	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
ECSF_RS06350	1278588..1278941	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
ECSF_RS06355	1279126..1280520	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T24472 WP_001531632.1 NC_013654:c1275686-1275579 [Escherichia coli SE15]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T24472 NC_013654:c1275686-1275579 [Escherichia coli SE15]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT24472 NC_013654:1275734-1275800 [Escherichia coli SE15]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin