Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 326375..326961 Replicon chromosome
Accession NZ_CP097076
Organism Klebsiella pneumoniae strain KP133

Toxin (Protein)


Gene name doc Uniprot ID A0A486RB10
Locus tag M3I84_RS01515 Protein ID WP_004174007.1
Coordinates 326593..326961 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M3I84_RS01510 Protein ID WP_004174006.1
Coordinates 326375..326596 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I84_RS01490 (322532) 322532..323458 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M3I84_RS01495 (323455) 323455..324732 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M3I84_RS01500 (324729) 324729..325496 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M3I84_RS01505 (325498) 325498..326211 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M3I84_RS01510 (326375) 326375..326596 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M3I84_RS01515 (326593) 326593..326961 + 369 WP_004174007.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M3I84_RS01520 (327234) 327234..328550 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M3I84_RS01525 (328657) 328657..329544 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M3I84_RS01530 (329541) 329541..330386 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M3I84_RS01535 (330388) 330388..331458 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 323455..332195 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T244713 WP_004174007.1 NZ_CP097076:326593-326961 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDLGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT244713 WP_004174006.1 NZ_CP097076:326375-326596 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486RB10

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References