Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2642668..2642997 | Replicon | chromosome |
| Accession | NZ_CP097069 | ||
| Organism | Enterococcus faecalis strain AT40a | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | M2912_RS12715 | Protein ID | WP_002396786.1 |
| Coordinates | 2642854..2642997 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2642668..2642743 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2912_RS12695 | 2638132..2638347 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| M2912_RS12700 | 2638486..2639478 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| M2912_RS12705 | 2639645..2640283 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| M2912_RS12710 | 2640968..2642584 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
| M2912_RS12715 | 2642854..2642997 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| M2912_RS12720 | 2643192..2647883 | - | 4692 | WP_010710853.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T244703 WP_002396786.1 NZ_CP097069:2642854-2642997 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 76 bp
>AT244703 NZ_CP097069:c2642743-2642668 [Enterococcus faecalis]
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTGTAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGAC
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTGTAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|