Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 304931..305126 | Replicon | chromosome |
| Accession | NZ_CP097069 | ||
| Organism | Enterococcus faecalis strain AT40a | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | M2912_RS01530 | Protein ID | WP_015543884.1 |
| Coordinates | 305031..305126 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 304931..304996 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2912_RS01515 | 300549..302291 | + | 1743 | WP_010710825.1 | PTS transporter subunit EIIC | - |
| M2912_RS01520 | 302282..304315 | + | 2034 | WP_078122716.1 | PRD domain-containing protein | - |
| M2912_RS01525 | 304326..304760 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - | 304931..304996 | + | 66 | - | - | Antitoxin |
| M2912_RS01530 | 305031..305126 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| M2912_RS01535 | 305372..307144 | + | 1773 | WP_010710824.1 | PTS mannitol-specific transporter subunit IIBC | - |
| M2912_RS01540 | 307159..307596 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| M2912_RS01545 | 307611..308765 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| M2912_RS01550 | 308833..309948 | - | 1116 | WP_010710823.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244693 WP_015543884.1 NZ_CP097069:c305126-305031 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT244693 NZ_CP097069:304931-304996 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|