Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2570990..2571432 | Replicon | chromosome |
| Accession | NZ_CP097066 | ||
| Organism | Enterococcus faecalis strain AT49a | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | M2922_RS12225 | Protein ID | WP_002392696.1 |
| Coordinates | 2570990..2571133 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2571234..2571432 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2922_RS12210 (2566239) | 2566239..2566952 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| M2922_RS12215 (2567213) | 2567213..2569957 | + | 2745 | WP_174113967.1 | glycoside hydrolase family 65 protein | - |
| M2922_RS12220 (2569972) | 2569972..2570622 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - (2570691) | 2570691..2570824 | + | 134 | NuclAT_15 | - | - |
| - (2570871) | 2570871..2571016 | + | 146 | NuclAT_13 | - | - |
| - (2570871) | 2570871..2571057 | + | 187 | NuclAT_10 | - | - |
| M2922_RS12225 (2570990) | 2570990..2571133 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2571246) | 2571246..2571391 | + | 146 | NuclAT_14 | - | - |
| - (2571234) | 2571234..2571432 | + | 199 | NuclAT_9 | - | Antitoxin |
| M2922_RS12230 (2571365) | 2571365..2571508 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
| M2922_RS13485 (2571916) | 2571916..2572041 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| M2922_RS12235 (2572246) | 2572246..2572452 | + | 207 | WP_258075960.1 | CPBP family intramembrane metalloprotease | - |
| M2922_RS12240 (2572505) | 2572505..2573476 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| M2922_RS12245 (2573651) | 2573651..2574088 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| M2922_RS12250 (2574221) | 2574221..2574775 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244678 WP_002392696.1 NZ_CP097066:c2571133-2570990 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 199 bp
>AT244678 NZ_CP097066:2571234-2571432 [Enterococcus faecalis]
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|