Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 308271..308465 | Replicon | chromosome |
| Accession | NZ_CP097066 | ||
| Organism | Enterococcus faecalis strain AT49a | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | M2922_RS01535 | Protein ID | WP_015543884.1 |
| Coordinates | 308370..308465 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 308271..308335 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2922_RS01520 (303890) | 303890..305632 | + | 1743 | WP_016627729.1 | PTS transporter subunit EIIC | - |
| M2922_RS01525 (305623) | 305623..307656 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
| M2922_RS01530 (307667) | 307667..308101 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (308271) | 308271..308335 | + | 65 | NuclAT_17 | - | Antitoxin |
| M2922_RS01535 (308370) | 308370..308465 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| M2922_RS01540 (308711) | 308711..310483 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
| M2922_RS01545 (310498) | 310498..310935 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| M2922_RS01550 (310950) | 310950..312104 | + | 1155 | WP_002395429.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| M2922_RS01555 (312171) | 312171..313286 | - | 1116 | WP_033785759.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244665 WP_015543884.1 NZ_CP097066:c308465-308370 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244665 NZ_CP097066:308271-308335 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|