Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2748417..2748702 | Replicon | chromosome |
| Accession | NZ_CP097059 | ||
| Organism | Enterococcus faecalis strain AT04 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | M2902_RS13200 | Protein ID | WP_077143780.1 |
| Coordinates | 2748562..2748702 (+) | Length | 47 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2748417..2748560 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2902_RS13175 | 2743569..2744201 | - | 633 | WP_002358972.1 | RloB family protein | - |
| M2902_RS13180 | 2744210..2745505 | - | 1296 | WP_002396787.1 | ATP-binding protein | - |
| M2902_RS13185 | 2745967..2747583 | + | 1617 | WP_002358967.1 | phosphatase PAP2/LCP family protein | - |
| M2902_RS13190 | 2747938..2748060 | + | 123 | WP_002404776.1 | putative holin-like toxin | - |
| M2902_RS13195 | 2748246..2748443 | + | 198 | WP_002358966.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - | 2748417..2748560 | - | 144 | - | - | Antitoxin |
| M2902_RS13200 | 2748562..2748702 | + | 141 | WP_077143780.1 | putative holin-like toxin | Toxin |
| M2902_RS13205 | 2748933..2749076 | + | 144 | WP_002396786.1 | putative holin-like toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 47 a.a. Molecular weight: 5188.30 Da Isoelectric Point: 10.3265
>T244653 WP_077143780.1 NZ_CP097059:2748562-2748702 [Enterococcus faecalis]
ISLKNTNKNIVYCTAYETIQTILGFGMFTIALIALIVKLLKNDKKK
ISLKNTNKNIVYCTAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 141 bp
Antitoxin
Download Length: 144 bp
>AT244653 NZ_CP097059:c2748560-2748417 [Enterococcus faecalis]
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAA
TGCTACAATAGAGACGAAAAGAGAGGTATGCTCTAACATACCTCTCTAGTGTAGAGCCGTTTAAGACGGTGACCTTTTTA
GTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|