Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 320278..320472 | Replicon | chromosome |
Accession | NZ_CP097059 | ||
Organism | Enterococcus faecalis strain AT04 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | M2902_RS01580 | Protein ID | WP_015543884.1 |
Coordinates | 320377..320472 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 320278..320342 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2902_RS01565 | 315890..317638 | + | 1749 | WP_010708249.1 | PTS transporter subunit EIIC | - |
M2902_RS01570 | 317629..319662 | + | 2034 | WP_085366518.1 | BglG family transcription antiterminator | - |
M2902_RS01575 | 319673..320107 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 320278..320342 | + | 65 | - | - | Antitoxin |
M2902_RS01580 | 320377..320472 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M2902_RS01585 | 320718..322490 | + | 1773 | WP_010784345.1 | PTS mannitol-specific transporter subunit IIBC | - |
M2902_RS01590 | 322505..322942 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
M2902_RS01595 | 322957..324111 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
M2902_RS01600 | 324179..325294 | - | 1116 | WP_002358395.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244634 WP_015543884.1 NZ_CP097059:c320472-320377 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244634 NZ_CP097059:320278-320342 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|