Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2644626..2644900 | Replicon | chromosome |
| Accession | NZ_CP097056 | ||
| Organism | Enterococcus faecalis strain AT09 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | M2903_RS12745 | Protein ID | WP_002392696.1 |
| Coordinates | 2644757..2644900 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2644626..2644824 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2903_RS12725 (2639631) | 2639631..2640344 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| M2903_RS12730 (2640605) | 2640605..2643349 | + | 2745 | WP_174113967.1 | glycoside hydrolase family 65 protein | - |
| M2903_RS12735 (2643364) | 2643364..2644014 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - (2644083) | 2644083..2644216 | + | 134 | NuclAT_15 | - | - |
| - (2644263) | 2644263..2644408 | + | 146 | NuclAT_13 | - | - |
| - (2644263) | 2644263..2644449 | + | 187 | NuclAT_10 | - | - |
| M2903_RS12740 (2644382) | 2644382..2644525 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - (2644638) | 2644638..2644783 | + | 146 | NuclAT_14 | - | - |
| - (2644626) | 2644626..2644824 | + | 199 | NuclAT_9 | - | Antitoxin |
| M2903_RS12745 (2644757) | 2644757..2644900 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| M2903_RS14420 (2645308) | 2645308..2645433 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| M2903_RS12750 (2645638) | 2645638..2645844 | + | 207 | WP_258075960.1 | CPBP family intramembrane metalloprotease | - |
| M2903_RS12755 (2645897) | 2645897..2646868 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| M2903_RS12760 (2647043) | 2647043..2647480 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| M2903_RS12765 (2647613) | 2647613..2648167 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244619 WP_002392696.1 NZ_CP097056:c2644900-2644757 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 199 bp
>AT244619 NZ_CP097056:2644626-2644824 [Enterococcus faecalis]
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|