Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 340929..341123 | Replicon | chromosome |
Accession | NZ_CP097056 | ||
Organism | Enterococcus faecalis strain AT09 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | M2903_RS01730 | Protein ID | WP_015543884.1 |
Coordinates | 341028..341123 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 340929..340993 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2903_RS01715 (336548) | 336548..338290 | + | 1743 | WP_016627729.1 | PTS transporter subunit EIIC | - |
M2903_RS01720 (338281) | 338281..340314 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
M2903_RS01725 (340325) | 340325..340759 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (340929) | 340929..340993 | + | 65 | NuclAT_17 | - | Antitoxin |
M2903_RS01730 (341028) | 341028..341123 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
M2903_RS01735 (341369) | 341369..343141 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
M2903_RS01740 (343156) | 343156..343593 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
M2903_RS01745 (343608) | 343608..344762 | + | 1155 | WP_002395429.1 | mannitol-1-phosphate 5-dehydrogenase | - |
M2903_RS01750 (344829) | 344829..345944 | - | 1116 | WP_033785759.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T244604 WP_015543884.1 NZ_CP097056:c341123-341028 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT244604 NZ_CP097056:340929-340993 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|