Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2752520..2752856 | Replicon | chromosome |
Accession | NZ_CP097048 | ||
Organism | Enterococcus faecalis strain AT22 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | M2906_RS13235 | Protein ID | WP_002396786.1 |
Coordinates | 2752520..2752663 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2752807..2752856 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2906_RS13215 (2747798) | 2747798..2748013 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2906_RS13220 (2748152) | 2748152..2749144 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2906_RS13225 (2749311) | 2749311..2749949 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
M2906_RS13230 (2750634) | 2750634..2752250 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
- (2752334) | 2752334..2752409 | - | 76 | NuclAT_7 | - | - |
- (2752307) | 2752307..2752423 | - | 117 | NuclAT_10 | - | - |
M2906_RS13235 (2752520) | 2752520..2752663 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- (2752807) | 2752807..2752856 | + | 50 | NuclAT_8 | - | Antitoxin |
- (2752595) | 2752595..2752857 | - | 263 | NuclAT_5 | - | - |
M2906_RS13240 (2752858) | 2752858..2757549 | - | 4692 | WP_010710853.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T244599 WP_002396786.1 NZ_CP097048:2752520-2752663 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244599 NZ_CP097048:2752807-2752856 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|