Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2666715..2666977 | Replicon | chromosome |
Accession | NZ_CP097048 | ||
Organism | Enterococcus faecalis strain AT22 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | M2906_RS12845 | Protein ID | WP_002392696.1 |
Coordinates | 2666834..2666977 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2666715..2666860 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2906_RS12825 (2662080) | 2662080..2662793 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
M2906_RS12830 (2662855) | 2662855..2663031 | - | 177 | WP_002396826.1 | hypothetical protein | - |
M2906_RS12835 (2663055) | 2663055..2665799 | + | 2745 | WP_025191898.1 | glycosyl hydrolase family 65 protein | - |
M2906_RS12840 (2665814) | 2665814..2666464 | + | 651 | WP_002367457.1 | beta-phosphoglucomutase | - |
- (2666715) | 2666715..2666860 | + | 146 | NuclAT_6 | - | Antitoxin |
- (2666715) | 2666715..2666901 | + | 187 | NuclAT_9 | - | - |
M2906_RS12845 (2666834) | 2666834..2666977 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
M2906_RS12850 (2667209) | 2667209..2668180 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
M2906_RS12855 (2668355) | 2668355..2668792 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
M2906_RS12860 (2668925) | 2668925..2669479 | - | 555 | WP_002354869.1 | Maf family protein | - |
M2906_RS12865 (2669504) | 2669504..2671636 | - | 2133 | WP_010710871.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244592 WP_002392696.1 NZ_CP097048:c2666977-2666834 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT244592 NZ_CP097048:2666715-2666860 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|