Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2699847..2700183 | Replicon | chromosome |
Accession | NZ_CP097046 | ||
Organism | Enterococcus faecalis strain AT29 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | M2907_RS12950 | Protein ID | WP_016619108.1 |
Coordinates | 2699847..2699990 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2700134..2700183 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2907_RS12930 (2695039) | 2695039..2696031 | + | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2907_RS12935 (2696198) | 2696198..2696836 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
M2907_RS12940 (2697522) | 2697522..2699138 | + | 1617 | WP_174114069.1 | phosphatase PAP2/LCP family protein | - |
M2907_RS12945 (2699467) | 2699467..2699616 | + | 150 | WP_002411240.1 | type I toxin-antitoxin system toxin PepG1 | - |
- (2699590) | 2699590..2699736 | - | 147 | NuclAT_12 | - | - |
- (2699549) | 2699549..2699750 | - | 202 | NuclAT_8 | - | - |
M2907_RS12950 (2699847) | 2699847..2699990 | + | 144 | WP_016619108.1 | putative holin-like toxin | Toxin |
- (2700134) | 2700134..2700183 | + | 50 | NuclAT_16 | - | Antitoxin |
- (2699922) | 2699922..2700184 | - | 263 | NuclAT_11 | - | - |
M2907_RS12955 (2700185) | 2700185..2704876 | - | 4692 | WP_174114070.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5191.13 Da Isoelectric Point: 8.6626
>T244583 WP_016619108.1 NZ_CP097046:2699847-2699990 [Enterococcus faecalis]
MNVSTKTYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKTYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244583 NZ_CP097046:2700134-2700183 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|