Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2608253..2608695 | Replicon | chromosome |
Accession | NZ_CP097046 | ||
Organism | Enterococcus faecalis strain AT29 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | M2907_RS12520 | Protein ID | WP_002392696.1 |
Coordinates | 2608253..2608396 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2608497..2608695 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2907_RS12505 (2603502) | 2603502..2604215 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
M2907_RS12510 (2604476) | 2604476..2607220 | + | 2745 | WP_174113967.1 | glycoside hydrolase family 65 protein | - |
M2907_RS12515 (2607235) | 2607235..2607885 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
- (2607954) | 2607954..2608087 | + | 134 | NuclAT_15 | - | - |
- (2608134) | 2608134..2608279 | + | 146 | NuclAT_13 | - | - |
- (2608134) | 2608134..2608320 | + | 187 | NuclAT_10 | - | - |
M2907_RS12520 (2608253) | 2608253..2608396 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2608509) | 2608509..2608654 | + | 146 | NuclAT_14 | - | - |
- (2608497) | 2608497..2608695 | + | 199 | NuclAT_9 | - | Antitoxin |
M2907_RS12525 (2608628) | 2608628..2608771 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
M2907_RS13775 (2609179) | 2609179..2609304 | - | 126 | WP_002383214.1 | hypothetical protein | - |
M2907_RS12530 (2609509) | 2609509..2609715 | + | 207 | WP_258075960.1 | CPBP family intramembrane metalloprotease | - |
M2907_RS12535 (2609768) | 2609768..2610739 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
M2907_RS12540 (2610914) | 2610914..2611351 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
M2907_RS12545 (2611484) | 2611484..2612038 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T244570 WP_002392696.1 NZ_CP097046:c2608396-2608253 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 199 bp
>AT244570 NZ_CP097046:2608497-2608695 [Enterococcus faecalis]
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
TTTTTAGGGAAATGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGA
CGGTGACCGATTATATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|