Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2662420..2662755 | Replicon | chromosome |
Accession | NZ_CP097042 | ||
Organism | Enterococcus faecalis strain AT34 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | M2910_RS12560 | Protein ID | WP_002415596.1 |
Coordinates | 2662420..2662563 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2662705..2662755 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2910_RS12540 (2657488) | 2657488..2657703 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2910_RS12545 (2657842) | 2657842..2658834 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2910_RS12550 (2659138) | 2659138..2659776 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
M2910_RS12555 (2660463) | 2660463..2662079 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
M2910_RS12560 (2662420) | 2662420..2662563 | + | 144 | WP_002415596.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2662496) | 2662496..2662754 | - | 259 | NuclAT_3 | - | - |
- (2662705) | 2662705..2662755 | + | 51 | NuclAT_13 | - | Antitoxin |
M2910_RS12565 (2662756) | 2662756..2666523 | - | 3768 | WP_104807327.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5314.46 Da Isoelectric Point: 10.6323
>T244555 WP_002415596.1 NZ_CP097042:2662420-2662563 [Enterococcus faecalis]
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 51 bp
>AT244555 NZ_CP097042:2662705-2662755 [Enterococcus faecalis]
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|