Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2583420..2583823 | Replicon | chromosome |
Accession | NZ_CP097042 | ||
Organism | Enterococcus faecalis strain AT34 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | M2910_RS12210 | Protein ID | WP_023894767.1 |
Coordinates | 2583719..2583823 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2583420..2583552 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2910_RS12195 (2578968) | 2578968..2579681 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
M2910_RS12200 (2579942) | 2579942..2582686 | + | 2745 | WP_104807179.1 | glycosyl hydrolase family 65 protein | - |
M2910_RS12205 (2582701) | 2582701..2583351 | + | 651 | WP_002375514.1 | beta-phosphoglucomutase | - |
- (2583420) | 2583420..2583552 | + | 133 | NuclAT_12 | - | Antitoxin |
- (2583599) | 2583599..2583786 | + | 188 | NuclAT_4 | - | - |
M2910_RS12210 (2583719) | 2583719..2583823 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
- (2583975) | 2583975..2584120 | + | 146 | NuclAT_11 | - | - |
- (2583975) | 2583975..2584161 | + | 187 | NuclAT_5 | - | - |
M2910_RS12215 (2584094) | 2584094..2584246 | - | 153 | WP_002375510.1 | type I toxin-antitoxin system toxin PepG1 | - |
M2910_RS12220 (2584471) | 2584471..2585442 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
M2910_RS12225 (2585617) | 2585617..2586054 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
M2910_RS12230 (2586187) | 2586187..2586741 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T244545 WP_023894767.1 NZ_CP097042:c2583823-2583719 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 133 bp
>AT244545 NZ_CP097042:2583420-2583552 [Enterococcus faecalis]
TGAAAAGAAAGATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTTACAAAAAATAACC
GTGCTTGATTAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
TGAAAAGAAAGATGCTTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTTACAAAAAATAACC
GTGCTTGATTAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACAGCTTTTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|