Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2718213..2718549 | Replicon | chromosome |
| Accession | NZ_CP097038 | ||
| Organism | Enterococcus faecalis strain AT39 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | M2911_RS12910 | Protein ID | WP_002381035.1 |
| Coordinates | 2718213..2718356 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2718500..2718549 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2911_RS12895 | 2713929..2714561 | - | 633 | WP_002358972.1 | RloB family protein | - |
| M2911_RS12900 | 2714570..2715865 | - | 1296 | WP_248882009.1 | ATP-binding protein | - |
| M2911_RS12905 | 2716327..2717943 | + | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
| M2911_RS12910 | 2718213..2718356 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - | 2718500..2718549 | + | 50 | - | - | Antitoxin |
| M2911_RS12915 | 2718551..2721550 | - | 3000 | WP_033786695.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T244537 WP_002381035.1 NZ_CP097038:2718213-2718356 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT244537 NZ_CP097038:2718500-2718549 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|